PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_35146-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 126aa    MW: 13890.8 Da    PI: 11.3905
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_35146-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45e-162266347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT++E+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky
  TRIUR3_35146-P1 22 PWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKY 66
                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.2451571IPR017930Myb domain
SuperFamilySSF466898.61E-191671IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-191870IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.7E-121965IPR009057Homeodomain-like
SMARTSM007171.5E-111969IPR001005SANT/Myb domain
CDDcd001675.16E-112267No hitNo description
PfamPF002495.1E-132266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MGHGYLSDGL MGRAQERKKG VPWTEDEHRR FLAGLEKLGK GDWRGISRHF VTTRTPTQVA  60
SHAQKYFLRQ AGLAQKKRRS SLFDVAPDLE LKISSTAARK TDQQAGAAAG SSPSPRTPFL  120
GTIRVT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6243991e-141KJ624399.1 Triticum aestivum MYBSM151 mRNA, complete cds.
GenBankKP3304791e-141KP330479.1 Triticum aestivum MYB transcription factor SM151 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455021.12e-52hypothetical protein SORBIDRAFT_03g003100
SwissprotQ8S9H71e-31DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM7Z0953e-88M7Z095_TRIUA; Transcription factor MYB1R1
STRINGMLOC_70777.24e-56(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42313873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-40MYB_related family protein